.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fcd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a putative glyoxalase from an environmental bacteria. To be Published
    Site NYSGXRC
    PDB Id 3fcd Target Id NYSGXRC-11004a
    Molecular Characteristics
    Source Unknown
    Alias Ids TPS27036,Q93AH5_9BACT, PF00903, 3.10.180.10 Molecular Weight 14025.33 Da.
    Residues 124 Isoelectric Point 4.77
    Sequence msdihqitpflhipdmqealtlfcdtlgfelkyrhsnyaylelsgcglrlleeparkiipdgiarvaic idvsdidslhtklspalenlpadqveplknmpygqrefqvrmpdgdwlnftapla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.92 Rfree 0.2762
    Matthews' coefficent 1.96 Rfactor 0.2296
    Waters 170 Solvent Content 37.34

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch