.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fcm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a NUDIX hydrolase from Clostridium perfringens. To be Published
    Site NYSGXRC
    PDB Id 3fcm Target Id NYSGXRC-11180j
    Molecular Characteristics
    Source Clostridium perfringens
    Alias Ids TPS27110,3.90.79.10, YP_695115.1 Molecular Weight 21996.93 Da.
    Residues 188 Isoelectric Point 5.85
    Sequence vnyiediknyipfneqeerdkelflrclndfhdiltrdntiahltssafavnkernkflmihhniynsw awtgghsdnekdqlkvaikelkeetgvknptplldkafaldvltvnghikrgkyvsshlhlnltyliec sedetlmlkedensgvmwipfneiskycsephmipiyeklinklktqskf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.280
    Matthews' coefficent 2.36 Rfactor 0.229
    Waters 115 Solvent Content 47.80

    Ligand Information
    Ligands
    Metals MN (MANGANESE) x 2

    Jmol

     
    Google Scholar output for 3fcm
    1. Structural and ligand-binding properties of a dual substrate specific enzyme from Schizosaccharomyces pombe
    JA Garza - 2009 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch