.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fcp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Muconate lactonizing enzyme from Klebsiella pneumoniae. To be Published
    Site NYSGXRC
    PDB Id 3fcp Target Id NYSGXRC-9450e
    Molecular Characteristics
    Source Klebsiella pneumoniae
    Alias Ids TPS27013,152970427 Molecular Weight 41312.95 Da.
    Residues 393 Isoelectric Point 5.42
    Sequence maqtpvmdvgtksyishqeqkmtatveqieswivdvptirphklsmttmgcqslvivrltrsdgicgig eattigglsygvespeaissaithyltpllkgqpadnlnaltarmngaikgntfaksaietalldaqgk alglpvsallggalqtalpvlwtlasgdtakdiaegekllaegrhrafklkigarelatdlrhtraive algdrasirvdvnqawdaatgakgcrelaamgvdlieqpvsahdnaalvrlsqqietailadeavatay dgyqlaqqgftgayalkiakaggpnsvlalarvaqaagiglyggtmlegtvgtvaslhawstlplqwgt emfgplllkddivsvpltfadgqvalpqtpglgveldedklhfytrqp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 1.80 Rfree 0.250
    Matthews' coefficent 2.93 Rfactor 0.229
    Waters 825 Solvent Content 58.04

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 8

    Jmol

     
    Google Scholar output for 3fcp
    1. On the combination of molecular replacement and single-wavelength anomalous diffraction phasing for automated structure determination
    S Panjikar, V Parthasarathy, VS Lamzin - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch