.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fd8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of an oxidoreductase from Enterococcus faecalis. To be Published
    Site NYSGXRC
    PDB Id 3fd8 Target Id NYSGXRC-11133e
    Molecular Characteristics
    Source Enterococcus faecalis
    Alias Ids TPS27059,3.40.50.720, AAO81041.1 Molecular Weight 39340.51 Da.
    Residues 349 Isoelectric Point 5.21
    Sequence mtvkmgfigfgksanryhlpyvmiretlevktifdlhvnekaaapfkekgvnftadlnelltdpeieli tictpahthydlakqailagksvivekpfcdtlehaeelfalgqekgvvvmpyqnrrfdgdylamkqvv eqgflgeinevethidyyrpgsiteqgpkengsfyglgihlmdrmialfgrpdqvtydirnnevseavd nyfdvdlhygsklkvkvktnhsvaspyprfivhgsngsfikygedqqendlkagimpdapgfgedspmy ygevtyrngngdwikkqiktpvgdygryydavyetlkngapqlvtkeqaltnieileagflnpspsvyhlken
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.45 Rfree 0.240
    Matthews' coefficent 2.59 Rfactor 0.196
    Waters 829 Solvent Content 52.56

    Ligand Information
    Ligands PGE (TRIETHYLENE) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch