.
The Open Protein Structure Annotation Network
PDB Keyword
.

3feq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Amidohydrolase Eah89906. To be Published
    Site NYSGXRC
    PDB Id 3feq Target Id NYSGXRC-9260c
    Related PDB Ids 3n2c 
    Molecular Characteristics
    Source Unknown
    Alias Ids TPS26999,PF01979 Molecular Weight 43670.43 Da.
    Residues 413 Isoelectric Point 5.42
    Sequence mtitvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpgfidchvhvlas nanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqavetglvsgprifpsgkalsqtg ghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavreeiqkgatqikimasggvasptdpiantqy sedeiraivdeaeaantyvmahaytgraiaravrcgvrtiehgnlvdeaaaklmhehgafvvptlvtyd alakhgaefgmppesvakvasvqqkgresleiyanagvkmgfgsdllgemhafqsgefriraevlgnle alrsattvaaeivnmqgqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrqaggr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 16
    Resolution (Å) 2.63 Rfree 0.28148
    Matthews' coefficent 2.75 Rfactor 0.23769
    Waters 145 Solvent Content 55.23

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 32

    Jmol

     
    Google Scholar output for 3feq
    1. Functional Annotation and Three-Dimensional Structure of Dr0930 from Deinococcus radiodurans, a Close Relative of Phosphotriesterase in the Amidohydrolase
    DF Xiang, P Kolb, AA Fedorov, MM Meier - Biochemistry, 2009 - ACS Publications
     
    2. At the periphery of the amidohydrolase superfamily: Bh0493 from Bacillus halodurans catalyzes the isomerization of D-galacturonate to D-tagaturonate
    TT Nguyen, S Brown, AA Fedorov, EV Fedorov - Biochemistry, 2008 - ACS Publications
     
    3. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    4. Functional annotation of two new carboxypeptidases from the amidohydrolase superfamily of enzymes
    DF Xiang, C Xu, D Kumaran, AC Brown, JM Sauder - Biochemistry, 2009 - ACS Publications
     
    5. A Common Catalytic Mechanism for Proteins of the HutI Family
    R Tyagi, S Eswaramoorthy, SK Burley, FM Raushel - Biochemistry, 2008 - ACS Publications
     
    6. The mechanism of the reaction catalyzed by uronate isomerase illustrates how an isomerase may have evolved from a hydrolase within the amidohydrolase
    TT Nguyen, AA Fedorov, LK Williams, EV Fedorov - Biochemistry, 2009 - ACS Publications
     
    7. Structure, mechanism, and substrate profile for Sco3058: The closest bacterial homologue to human renal dipeptidase
    JA Cummings, TT Nguyen, AA Fedorov, P Kolb - Biochemistry, 2009 - ACS Publications
     
    8. Functional identification and structure determination of two novel prolidases from cog1228 in the amidohydrolase superfamily
    DF Xiang, Y Patskovsky, C Xu, AA Fedorov - Biochemistry, 2010 - ACS Publications
     
    9. Gulosibacter molinativorax ON4T Molinate Hydrolase, a Novel Cobalt-Dependent Amidohydrolase
    M Duarte, F Ferreira-da-Silva, H Lnsdorf - Journal of , 2011 - Am Soc Microbiol
     
    10. Molinate hydrolase from Gulosibacter molinativorax ON4T-a novel cobalt dependent amidohydrolase
    M Duarte, F Ferreira-da-Silva, H Lnsdorf - Journal of , 2011 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch