.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fhl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Putative Oxidoreductase from Bacteroides Fragilis Nctc 9343. To be Published
    Site NYSGXRC
    PDB Id 3fhl Target Id NYSGXRC-11148k
    Molecular Characteristics
    Source Bacteroides fragilis
    Alias Ids TPS27078,YP_211962.1, 3.40.50.720 Molecular Weight 39750.32 Da.
    Residues 352 Isoelectric Point 5.93
    Sequence meiiktglaafgmsgqvfhapfistnphfelykiverskelskerypqasivrsfkeltedpeidlivv ntpdnthyeyagmaleagknvvvekpftsttkqgeelialakkkglmlsvyqnrrwdadfltvrdilak sllgrlveyestfaryrnfikpntwketgesgggltynlgshlidqaiqlfgmpeavfadlgilreggk vddyfiihllhpslapnvkitlkasylmreaeprfalhgtlgsyvkygvdkqeaallageiperpnwge eseqewgllhteingkeicrkypgiagnyggfyqniyehlclgqplethaqdilnviriieaayqshre nkivnlk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.93 Rfree 0.21503
    Matthews' coefficent 2.83 Rfactor 0.18601
    Waters 1019 Solvent Content 56.60

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 3fhl
    1. Parallel Protein Docking Tool
    I Sovic, N Antulov-Fantulin, I Canadi - 2010 Proceedings of , 2010 - ieeexplore.ieee.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch