The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of malate dehydrogenase from Porphyromonas gingivalis. To be Published
    Site NYSGXRC
    PDB Id 3fi9 Target Id NYSGXRC-11146m
    Molecular Characteristics
    Source Porphyromonas gingivalis
    Alias Ids TPS27074,NP_906031.1, Molecular Weight 36184.66 Da.
    Residues 334 Isoelectric Point 6.33
    Sequence msylteekltivgaagmigsnmaqtaammrltpnlclydpfavglegvaeeirhcgfeglnltftsdik ealtdakyivssggaprkegmtredllkgnaeiaaqlgkdiksycpdckhviiifnpaditglvtliys glkpsqvttlagldstrlqselakhfgikqslvtntrtygghgeqmavfastakvngtpltdligtdkl tneqwaelkqrvvkgganiiklrgrssfqspsyvsiemiraamggeafrwpagcyvnvpgfehimmame ttitkdgvkysdinqlgneaeraalkesyshlaklrdeviamgiipaiadwktvnpnl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.295
    Matthews' coefficent 2.40 Rfactor 0.252
    Waters 413 Solvent Content 48.73

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch