.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fij

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a uncharacterized protein lin1909. To be Published
    Site NYSGXRC
    PDB Id 3fij Target Id NYSGXRC-11172j
    Molecular Characteristics
    Source Listeria innocua
    Alias Ids TPS27100,3.40.50.880, CAC97139.1 Molecular Weight 27028.56 Da.
    Residues 244 Isoelectric Point 5.59
    Sequence mkpvigitgnrlvkgvdvfyghrvtytqqryvdaiqkvggfpialpiddpstavqaislvdgllltggq ditpqlyleepsqeigayfpprdsyeialvraaldagkpifaicrgmqlvnvalggtlyqdisqvetka lqhlqrvdeqlgshtidieptselakhhpnkklvnslhhqfikklapsfkvtartadgmieavegdnlp swylgvqwhpelmfqtdpeseqlfqalvdeskktmvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.30 Rfree 0.269
    Matthews' coefficent 2.31 Rfactor 0.217
    Waters 620 Solvent Content 46.82

    Ligand Information
    Ligands
    Metals MN (MANGANESE) x 8

    Jmol

     
    Google Scholar output for 3fij
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch