.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fjy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a probable MutT1 protein from Bifidobacterium adolescentis. To be Published
    Site NYSGXRC
    PDB Id 3fjy Target Id NYSGXRC-11181h
    Molecular Characteristics
    Source Bifidobacterium adolescentis
    Alias Ids TPS27112,3.90.79.10, YP_908989.1 Molecular Weight 40563.00 Da.
    Residues 362 Isoelectric Point 6.54
    Sequence msekmrriveaaggivwrwkagsdiandpaiassksaqeqldsievcivhrpkyddwswpkgkleqnet hrhaavreigeetgspvklgpylceveyplseegkktrhshdctadtkhtlywmaqpisaddaehllda fgpvhradvgeindivwvsvrearkilshstdkdtlavfvdrvqegaataqnllivrhakaesrkswkg tdanrpitpkgaamafalnrelacfnptrlatspwlrcqetlqvlswqterpmehintltedafaehpa vswlafreqitqtlnsrettaicmhrpviggmydhlrglcarkqlakqliakspymptgtamslfiidt pqgpsiidiqkvspivy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.15 Rfree 0.263
    Matthews' coefficent 2.67 Rfactor 0.223
    Waters 289 Solvent Content 53.90

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 3fjy
    1. Crystal structure of a metal_dependent phosphoesterase (YP_910028. 1) from Bifidobacterium adolescentis: Computational prediction and experimental validation of
    GW Han, J Ko, CL Farr, MC Deller, Q Xu - Proteins: Structure, , 2011 - Wiley Online Library
     
    2. Structural and ligand-binding properties of a dual substrate specific enzyme from Schizosaccharomyces pombe
    JA Garza - 2009 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch