The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of RuBisCO-like protein from Bacillus Cereus ATCC 14579. To be Published
    Site NYSGXRC
    PDB Id 3fk4 Target Id NYSGXRC-9463a
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS27032,PF00016, NP_833754 Molecular Weight 45460.71 Da.
    Residues 414 Isoelectric Point 6.38
    Sequence msgiiatylihddshnlekkaeqialgltigswthlphllqeqlkqhkgnvihveelaehehtnsylrk kvkrgiikieypllnfspdlpailtttfgklsldgevklidltfsdelkkhfpgpkfgidgirnllqvh drpllmsifkgmigrnigylktqlrdqaiggvdivkddeilfenaltpltkrivsgkevlqsvyetygh ktlyavnltgrtfdlkenakravqagadillfnvfaygldvlqslaeddeipvpimahpavsgaysask lygvssplllgkllryagadfslfpspygsvalekeealaiskylteddasfkksfsvpsagihpgfvp fivrdfgkdvvinagggihghpngaqgggkafrtaidatlqnkplhevddinlhsalqiwgnpsyevkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.257
    Matthews' coefficent 2.84 Rfactor 0.235
    Waters 160 Solvent Content 56.76

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch