.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fk9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of mMutator MutT protein from Bacillus halodurans. To be Published
    Site NYSGXRC
    PDB Id 3fk9 Target Id NYSGXRC-11178d
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS27102,3.90.79.10, NP_244437.1 Molecular Weight 18548.60 Da.
    Residues 159 Isoelectric Point 5.78
    Sequence lqrvtncivvdhdqvlllqkprrgwwvapggkmeagesiletvkreyweetgitvknpelkgifsmvif degkivsewmlftfkatehegemlkqspegklewkkkdevlelpmaagdkwifkhvlhsdrllygtfhy tpdfellsyrldpepqmkkgv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.293
    Matthews' coefficent 2.00 Rfactor 0.222
    Waters 5 Solvent Content 38.36

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3fk9
    1. Crystal structure of human MTH1 and the 8-oxo-dGMP product complex
    LM Svensson, AS Jemth, M Desroses, O Loseva - FEBS letters, 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch