The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of L-threonine-O-3-phosphate decarboxylase from Porphyromonas gingivalis. To be Published
    Site NYSGXRC
    PDB Id 3fkd Target Id NYSGXRC-11247b
    Molecular Characteristics
    Source Porphyromonas gingivalis
    Alias Ids TPS27162,3.40.640.10, NP_904371.1, PF00155 Molecular Weight 39021.37 Da.
    Residues 342 Isoelectric Point 5.88
    Sequence mifghgdegitplsseivnfsttvwtdgdkdhlekhlvenlncirhypepdagtlrqmlakrnsvdnna ilvtngptaafyqiaqafrgsrsliaipsfaeyedacrmyehevcfypsnedigeadfsnmdfcwlcnp nnpdgrllqrteilrllndhpdttfvldqsyvsftteevirpadikgrknlvmvysfshaygipglrig yivankdfmkrvaafstpwavnalaieaakfilihpaqftlpirkwqrntvdfitalnrldgvevhpsg ttffllrlkkgtaaelkkymleeynmlirdasnfrgldesyvrittqrpaqnqlfikaletfleky
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.2745
    Matthews' coefficent 2.57 Rfactor 0.2240
    Waters 298 Solvent Content 52.14

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch