.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fn9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of putative beta-galactosidase from bacteroides fragilis. To be published
    Site NYSGXRC
    PDB Id 3fn9 Target Id NYSGXRC-11098j
    Molecular Characteristics
    Source Bacteroides fragilis
    Alias Ids TPS27048,3.20.20.80, CAH05808.1 Molecular Weight 80497.10 Da.
    Residues 704 Isoelectric Point 6.86
    Sequence mrklsyliivclclcsgviplmarqvtafntgwqfkkgpfatdpmraasqwdgkwetveiphtwnamdm qvqsgsfyegagyyrktqffphdlegkrvflrfegvgacaevyvngklagthkggysafaceigtalkl gaeneiivkadnkarpdvipvnqnlfgvyggiyrpvwlivteqnnitvtdcaspgvyitqkdvskksad itvkvkldnaglqpaavtlentiytqegqkvgthsrsfdlspqgtqtylstfklknphlwqgrkdpyly kvvcrlmadgkvidevvqplgvrkyeivagkgfflngekysmygvtrhqdwwglgsalknehhdfdlaa imdvgattvrfahyqqsdylysrcdtlgliiwaeipcvnrvtgyetenaqsqlrelirqsfnhpsiyvw glhnevyqpheytaaltrslhdlaktedpdrytvsvngyghmdhpvnlnadiqgmnryfgwyekkiqdi kpwveqlekdypyqklmlteygadanlahqteylgdalnwgkpfypetfqtktheyqwsiikdhpyiia sylwnmfdfavpmwtrggvparnmkglitfdrktkkdsyfwykanwseepvlyltqrrnadrekrttav tvysnigtpkvylngqelsgirngytdvhyvfdnvsladgknilkavvstkgkeytdeiewnysgeknr eidsyenknehsgf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.70 Rfree 0.270
    Matthews' coefficent 2.54 Rfactor 0.201
    Waters 92 Solvent Content 51.53

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 7

    Jmol

     
    Google Scholar output for 3fn9
    1. Mapping the ligand-binding pocket of integrin alpha5beta1 using a gain-of-function approach
    A Mould, E Koper, A Byron, G Zahn, M Humphries - Biochem. J, 2009 - biochemj.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch