.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fnd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a chitinase from Bacteroides thetaiotaomicron. To be Published
    Site NYSGXRC
    PDB Id 3fnd Target Id NYSGXRC-11092m
    Related PDB Ids 3co4 
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron
    Alias Ids TPS7899,AAO77931.1, 3.20.20.80 Molecular Weight 39961.29 Da.
    Residues 347 Isoelectric Point 6.03
    Sequence mkhvlyalltavsilftscgpssntnnpqvpnvpqpqpqpqpevtqkvvigylalddwefeslfptiew kylthinasfarvkadgtlninpvrkriesvretahkhnvkilislaknspgefttaindpkarkeliq qiiaftkeykldgfdidyeeydnwdknfpsllvfarglylakeknmlmtcavnsrwlnygteweqyfdy inlmsydrgaftdkpvqhasyddfvkdlkywneqcraskskivgglpfygysweeslqgavddvrgiry sgilkhlgneaadkdnigktyyngrptiankckfikendyagvmiwqlfqdahndnydlklinvvgremme
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.231
    Matthews' coefficent 2.04 Rfactor 0.188
    Waters 292 Solvent Content 39.85

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch