.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fnr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF A PUTATIVE ARGINYL T-RNA SYNTHETASE FROM Campylobacter jejuni. To be Published
    Site NYSGXRC
    PDB Id 3fnr Target Id NYSGXRC-13562a
    Molecular Characteristics
    Source Campylobacter jejuni
    Alias Ids TPS26970,PF00750, CAL35290.1 Molecular Weight 60168.46 Da.
    Residues 530 Isoelectric Point 5.98
    Sequence lksiifneikkilecdfalenpkdknlahfatplafslakelkkspmliasdlaskfqnhdcfesveav ngylnfrisktflnelanqaltnpndftkgekkqesflleyvsanptgplhighargavfgdtltrlar hlgykfnteyyvndagnqiyllglsillsvkesilhenveypeqyykgeyivdlakeafekfgkeffse enipsladwakdkmlvlikqnleqakikidsyvsersyydalnatleslkehkgiyeqegkiwlassqk gdekdrviiredgrgtylaadivyhkdkmsrgygkciniwgadhhgyiprmkaameflgfdsnnleiil aqmvsllkdgepykmskragnfilmsdvvdeigsdalryiflskkcdthlefdisdlqkedssnpvyyi nyaharihqvfakagkkiddvmkadlqslnqdgvnllfealnlkavlndafearalqkipdylknlaan fhkfynenkvvgsanendllklfslvalsiktafslmgieaknkmeh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.25785
    Matthews' coefficent 3.27 Rfactor 0.21375
    Waters 152 Solvent Content 62.38

    Ligand Information
    Ligands SO4 (SULFATE) x 4;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3fnr
    1. Ferredoxin and Flavodoxin Mediated Electron Transfer in Photosystem I
    R Fromme - Photosynthetic Protein Complexes, 2008 - Wiley Online Library
     
    2. A structural approach of R A-protein recognition and kinetics of binding in two examples: tR A aminoacylation by arginyl-tR A synthetase and 7SK stabilization
    E Uchikawa - 2011 - scd-theses.u-strasbg.fr
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch