.
The Open Protein Structure Annotation Network
PDB Keyword
.

3frn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF flagellar protein FlgA FROM Thermotoga maritima. To be Published
    Site NYSGXRC
    PDB Id 3frn Target Id NYSGXRC-10063z
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS27180,PF03240, Q9X1M7 Molecular Weight 32615.46 Da.
    Residues 286 Isoelectric Point 5.50
    Sequence mkvllilivlissflfsetltlketllaspgvlfldditiekveseknlmillpgleylvtrdllrtkf peydftgpenvritvegysslknavfeeigkkaeakdfeafvvktfgtlpekfepqtirvtkisknlfs vflrfpdtyvtlnmllrkernvvvlkrninvgdvikeedvrlekrnvfeiygepffdvsevvgkisrry lkegtvltadmvkdppdvvkgqvvpayvdmgsikvttfvevlengylgetvramnvesrkyvfgrverg pvlrilevve
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.28198
    Matthews' coefficent 2.00 Rfactor 0.24090
    Waters 47 Solvent Content 44.02

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch