.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fyy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Computation-facilitated assignment of the function in the enolase superfamily: a regiochemically distinct galactarate dehydratase from Oceanobacillus iheyensis . Biochemistry 48 11546-11558 2009
    Site NYSGXRC
    PDB Id 3fyy Target Id NYSGXRC-9375a
    Related PDB Ids 3es8 3es7 2oqy 3gd6 
    Molecular Characteristics
    Source Oceanobacillus iheyensis
    Alias Ids TPS7829,PF02746 Molecular Weight 44340.13 Da.
    Residues 391 Isoelectric Point 5.80
    Sequence mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgllsillgqnp fdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdflggrvkekikvcypifrhr fseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvkeefgsrvriksydfshllnwkdahrai krltkydlglemiespaprndfdglyqlrlktdypisehvwsfkqqqemikkdaidifnispvfigglt sakkaayaaevaskdvvlgttqelsvgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgyl yapdrsvkglgieldesllakyqvpdlswdnvtvhqlqdrtadtks
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.234
    Matthews' coefficent 2.50 Rfactor 0.208
    Waters 578 Solvent Content 50.75

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 4

    Jmol

     
    Google Scholar output for 3fyy
    1. An antibiotic-resistance enzyme from a deep-sea bacterium
    M Toth, C Smith, H Frase, S Mobashery - Journal of the , 2009 - ACS Publications
     
    2. Computation-facilitated assignment of the function in the enolase superfamily: A regiochemically distinct galactarate dehydratase from Oceanobacillus iheyensis
    JF Rakus, C Kalyanaraman, AA Fedorov - Biochemistry, 2009 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch