.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g0o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of 3-hydroxyisobutyrate dehydrogenase (ygbJ) from Salmonella typhimurium. To be Published
    Site NYSGXRC
    PDB Id 3g0o Target Id NYSGXRC-11128h
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS27057,AAL21798.1, 3.40.50.720 Molecular Weight 31259.95 Da.
    Residues 307 Isoelectric Point 4.96
    Sequence mttgtdfhvgivglgsmgmgaarsclraglstwgadlnpqacanllaegacgaaasarefagvvdalvi lvvnaaqvrqvlfgedgvahlmkpgsavmvsstissadaqeiaaaltalnlnmldapvsggavkaaqge mtvmasgseaaftrlkpvldavasnvyrisdtpgagstvkiihqllagvhiaaaaeamalaaragipld vmydvvthaagnswmfenrmqhvvdgdytprsavdifvkdlglvadtakalrfplplastalnmftsas nagygkeddsavikifsgitlpgvtpeepsc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.233
    Matthews' coefficent 3.78 Rfactor 0.207
    Waters 319 Solvent Content 67.42

    Ligand Information
    Ligands TLA (L(+)-TARTARIC) x 1
    Metals CL (CHLORIDE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch