.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g12

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative lactoylglutathione lyase from Bdellovibrio bacteriovorus. To be Published
    Site NYSGXRC
    PDB Id 3g12 Target Id NYSGXRC-11004t
    Molecular Characteristics
    Source Bdellovibrio bacteriovorus
    Alias Ids TPS27038,PF00903, 3.10.180.10, Q6MK89_BDEBA Molecular Weight 13026.36 Da.
    Residues 118 Isoelectric Point 5.42
    Sequence msllitsitintshlqgmlgfyriigfqftaskvdkgsevhravhngvefslysiqnpqrsqipslqlg fqitdlektvqelvkipgamcildptdmpdgkkaivldpdghsielcel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.58 Rfree 0.27481
    Matthews' coefficent 2.11 Rfactor 0.21211
    Waters 30 Solvent Content 41.65

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3g12
    1. Structural and functional bases for allosteric control of MMP activities: Can it pave the path for selective inhibition?
    N Sela-Passwell, G Rosenblum, T Shoham - Biochimica et Biophysica , 2010 - Elsevier
     
    2. New opportunities in drug design of metalloproteinase inhibitors: combination between structurefunction experimental approaches and systems biology
    N Sela-Passwell, A Trahtenherts - Expert Opinion on , 2011 - ingentaconnect.com
     
    3. Structural and Functional Studies on Trimeric Autotransporters
    J Leo - 2009 - doria.fi
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch