.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g13

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative conjugative transposon recombinase from Clostridium difficile. To be Published
    Site NYSGXRC
    PDB Id 3g13 Target Id NYSGXRC-11223f
    Molecular Characteristics
    Source Clostridium difficile
    Alias Ids TPS27142,3.40.50.1390, YP_001089888.1, PF00239 Molecular Weight 67341.12 Da.
    Residues 586 Isoelectric Point 7.43
    Sequence mqevevikarnvlskqargkaierlrvaaycrvstdsedqlnsyksqvqyytdmikknkewvladiyad eaitgtqvtkredfqrmindcmngeidmvitksisrfarntldtlkyvrmlkerniavyfedekintlt mdgelllvvlssvaqqevenisanvkkglkmkmkrgelvgfqgclgydyhpedktitvnqeeaeivryi fnryvdgaggsvigqelenlgyktkygsstwapstvigiiknekykgdillgktftvdpiskrrlenmg eedkfymkdhhepiiseevfekaqeilnrrnknrttvgsgkrekysrkyafscmlecgfcggtltrrnw hsgsqyskviwqcvtatkkgkkfckhskgipetaieeafvesyrllcddnkdvleeflqrmddtlsssv vskqlakaekeidalekkksklvdmrleeiidketyeskyadlvskqeqlveerqklqetsdnekdikk rlkefkktleqnevldkfdryvfesivekvivggldengnvdpaqltfvyktglknsvdgakfkpqrkn ergrhrtnelcshdsnevdkmcsdssndtcgncs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.23918
    Matthews' coefficent 2.69 Rfactor 0.19900
    Waters 184 Solvent Content 54.31

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals NA (SODIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch