.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g17

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of putative 2-dehydropantoate 2-reductase from staphylococcus aureus. To be published
    Site NYSGXRC
    PDB Id 3g17 Target Id NYSGXRC-11137b
    Molecular Characteristics
    Source Staphylococcus aureus
    Alias Ids TPS27061,3.40.50.720, BAB58762.1 Molecular Weight 32432.48 Da.
    Residues 286 Isoelectric Point 5.60
    Sequence mlsvaiigpgavgttiayelqqslphttligrhaktityytvphapaqdivvkgyedvtntfdviiiav kthqldaviphltylahedtliilaqngygqlehipfknvcqavvyisgqkkgdvvthfrdyqlriqdn altrqfrdlvqdsqidivleaniqqaiwykllvnlginsitalgrqtvaimhnpeirilcrqllldgcr vaqaeglnfseqtvdtimtiyqgypdemgtsmyydivhqqpleveaiqgfiyrrarehnldtpyldtiy sflrayqqnm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.30 Rfree 0.260
    Matthews' coefficent 2.52 Rfactor 0.200
    Waters 396 Solvent Content 51.18

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3g17
    1. Detecting subtle functional differences in ketopantoate reductase and related enzymes using a rule-based approach with sequence-structure homology recognition
    S Mondal, C Nagao, K Mizuguchi - Protein Engineering Design , 2010 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch