.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g1t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF short chain dehydrogenase from Salmonella enterica subsp. enterica serovar Typhi str. CT18. To be Published
    Site NYSGXRC
    PDB Id 3g1t Target Id NYSGXRC-13837d
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS26981,AAV77120.1, PF00106 Molecular Weight 28071.55 Da.
    Residues 253 Isoelectric Point 6.96
    Sequence mhyqpkqdllqnriilvtgasdgigreaaltyarygatvillgrneeklrrvaqhiadeqhvqpqwftl dlltctaeecrqvadriaahyprldgvlhnagllgeigpmseqdpqiwqdvmqvnvnatfmltqallpl llksdagslvftsssvgrqgranwgayatskfategmmqvladeyqnrslrvncinpggtrtsmrasaf ptedpqklktpadimplylwlmgddsrrktgmtfdaqpgrkpgiaq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.232
    Matthews' coefficent 2.23 Rfactor 0.185
    Waters 254 Solvent Content 44.89

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch