The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of sugar ABC transporter (sugar-binding protein) from Bacillus halodurans. To be Published
    Site NYSGXRC
    PDB Id 3g1w Target Id NYSGXRC-11229f
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS27146,, NP_244315.1, PF00072 Molecular Weight 36903.56 Da.
    Residues 335 Isoelectric Point 4.50
    Sequence mkklllvyvaliglfmlyvyhahfkepvanpwdtrglqgdlnetymmitfqsgmdywkrclkgfedaaq alnvtveyrgaaqydiqeqitvleqaiaknpagiaisaidpveltdtinkavdagipivlfdsgapdsh ahsflgtnnynagmnaaykmaelldgegevavitlpnqlnhqerttgfketleaefpaieviavedgrg dslhsrrvahqlledypnlagifateanggvgvgdavrlesrageiqiisfdtdkgtldlvdegiisat laqgtwnmgywsltylfhlhhgltepqilqtreeaplplyvdtgitivtdenvdyyyad
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.02 Rfree 0.23711
    Matthews' coefficent 2.23 Rfactor 0.19308
    Waters 229 Solvent Content 44.78

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch