.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g2e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of putative OORC subunit of 2-oxoglutarate:acceptor oxidoreductase from Campylobacter jejuni. To be Published
    Site NYSGXRC
    PDB Id 3g2e Target Id NYSGXRC-13906a
    Molecular Characteristics
    Source Campylobacter jejuni
    Alias Ids TPS26990,CAL34684.1, PF01558 Molecular Weight 20096.07 Da.
    Residues 185 Isoelectric Point 5.68
    Sequence mkyqlrfggeggqgvitageilaeaaikegrqafkastytsqvrggptkvdiiiddkeilfpyavegev dfmlstadkgykgfrggvkeggiivvepnlvhpesedykkwqifeipiitiakdevgnvatqsvvalai aaymskcidldvlketmlhmvpaktrdanakafdlgvkyatqakphs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.232
    Matthews' coefficent 2.44 Rfactor 0.183
    Waters 382 Solvent Content 49.56

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3g2e
    1. Progress in super long loop prediction
    S Zhao, K Zhu, J Li, RA Friesner - Proteins: Structure, Function, , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch