The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of S-Adenosylmethionine Dependent Methyltransferase from Listeria Monocytogenes. To be Published
    Site NYSGXRC
    PDB Id 3g5l Target Id NYSGXRC-13848a
    Molecular Characteristics
    Source Listeria monocytogenes
    Alias Ids TPS26984,AAT04100.1, PF08241 Molecular Weight 28141.62 Da.
    Residues 243 Isoelectric Point 5.87
    Sequence mkenkyddkhffeqysqmprskeglkaagewhelkkmlpdfnqktvldlgcgfgwhciyaaehgakkvl gidlsermlteakrkttspvvcyeqkaiediaiepdaynvvlsslalhyiasfddickkvyinlkssgs fifsvehpvftadgrqdwytdetgnklhwpvdryfnesmrtshflgedvqkyhrtvttyiqtllkngfq insviepepapelkdlpemqdeyrrpmmllisatkq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.35 Rfree 0.27618
    Matthews' coefficent 2.23 Rfactor 0.18953
    Waters 135 Solvent Content 44.96

    Ligand Information
    Metals CL (CHLORIDE) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch