.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g79

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of NDP-N-acetyl-D-galactosaminuronic acid dehydrogenase from Methanosarcina mazei Go1. To be Published
    Site NYSGXRC
    PDB Id 3g79 Target Id NYSGXRC-11151g
    Molecular Characteristics
    Source Methanosarcina mazei
    Alias Ids TPS27084,NP_633178.1, 3.40.50.720 Molecular Weight 51790.84 Da.
    Residues 478 Isoelectric Point 6.16
    Sequence vismsklekllkergpikkigvlgmgyvgipaavlfadapcfekvlgfqrnskssgykiemlnrgespl kgeepgleeligkvvkagkfectpdfsriseldavtlaiqtpfanpkdlepdfsalidgirnvgkylkp gmlvvlestitpgttegmakqileeesglkagedfalahapervmvgrllknirehdrivggideastk ravelyspvltvgqvipmsataaevtktaentfrdlqiaainqlalyceamginvydvrtgvdslkgeg itravlwpgagvgghcltkdtyhlergvkigrgeldypegadsiyvlarkvndfmpahmynltvaaler lgkkmdgskvamlgwafikdsddarntpsepyrdlclkagasvmvhdpyvvnypgveisdnleevvrna daivvlaghsaysslkadwakkvsakanpviidgrnviepdefigkgfvykgigrgdknshkik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.296
    Matthews' coefficent 2.54 Rfactor 0.222
    Waters 179 Solvent Content 51.63

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch