.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g7s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a long-chain-fatty-acid-CoA ligase (FadD1) from Archaeoglobus fulgidus. To be Published
    Site NYSGXRC
    PDB Id 3g7s Target Id NYSGXRC-11193j
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS27120,NP_068930.1, 3.30.300.30, PF00501 Molecular Weight 60993.21 Da.
    Residues 542 Isoelectric Point 5.30
    Sequence melkykigfpslyypkisladridaaaekfgektaiisaepkfpsefpesmnfleicevtkklasgisr kgvrkgehvgvcipnsidyvmtiyalwrvaatpvpinpmyksfelehilndseattlvvhsmlyenfkp vlektgvervfvvggevnslsevmdsgsedfenvkvnpeedvalipytggttgmpkgvmlthfnlaana lqlavatglshmdtivgcmpmfhsaefglvnlmvtvgneyvvmgmfnqemlaeniekykgtfswavppa lnvlvntlessnktydwsylkvfatgawpvapalvekllklaaekcnnprlrhnqiwgmteacpmvttn pplrldksttqgvpmsdielkvisledgrelgvgesgeivirgpnifkgywkrekenqecwwydekgrk ffrtgdvgfideegflhfqdrvkevikykgytiapfeleallmkheavmdvavigkpdeeagevpkafi vlkpeyrgkvdeediiewvrerisgykrvrevefveelprtasgkllrrllrekeaekg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.15 Rfree 0.256
    Matthews' coefficent 2.21 Rfactor 0.222
    Waters 230 Solvent Content 44.32

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3g7s
    1. Conformational dynamics in the Acyl-CoA synthetases, adenylation domains of non-ribosomal peptide synthetases, and firefly luciferase
    AM Gulick - ACS chemical biology, 2009 - ACS Publications
     
    2. Bioinformatic Analysis of Leishmania donovani Long-Chain Fatty Acid-CoA Ligase as a Novel Drug Target
    J Kaur, R Tiwari, A Kumar, N Singh - Molecular biology international, 2011 - hindawi.com
     
    3. Aminoacyl-coenzyme A synthesis catalyzed by a CoA ligase from Penicillium chrysogenum
    MJ Koetsier, PA Jekel, HJ Wijma, RAL Bovenberg - FEBS letters, 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch