.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g85

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of LacI family transcription regulator from Clostridium acetobutylicum. To be Published
    Site NYSGXRC
    PDB Id 3g85 Target Id NYSGXRC-11230o
    Molecular Characteristics
    Source Clostridium acetobutylicum
    Alias Ids TPS27148,3.40.50.2300, NP_350138.1, PF00532 Molecular Weight 37197.78 Da.
    Residues 335 Isoelectric Point 9.34
    Sequence mstikdvaklsgvspstvsiilngnaskrnisertqrkvmdsvkklnyhpniaarklrsknsqskptia lywssdisvniisrflrglqsklakqnynynvvicpyktdclhlekgiskensfdaaiianisnydley lnkasltlpiilfnrlsnkyssvnvdnykmgekasllfakkryksaaailteslndamdnrnkgfietc hkngikisenhiiaaensihggvdaakklmklkntpkalfcnsdsialgvisvlnkrqisipddieiva igmndreytefstppvtivdipieemagtcislveklinrdienptsilfdgplilrns
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.84 Rfree 0.23035
    Matthews' coefficent 2.58 Rfactor 0.18390
    Waters 214 Solvent Content 52.27

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch