.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g8r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative spore coat polysaccharide biosynthesis protein E from Chromobacterium violaceum ATCC 12472. To be Published
    Site NYSGXRC
    PDB Id 3g8r Target Id NYSGXRC-11105i
    Molecular Characteristics
    Source Chromobacterium violaceum
    Alias Ids TPS27051,3.20.20.70, NP_903560.1 Molecular Weight 56270.05 Da.
    Residues 495 Isoelectric Point 6.01
    Sequence mskplfifemannhmgnvehgvalirairescqgfdfdfgfklqyrnldtfihssfkgrddvkyvkrfe etrlqpeqmqklvaemkangfkaictpfdeesvdlieahgieiikiascsftdwplleriarsdkpvva stagarredidkvvsfmlhrgkdltimhcvaeyptpddhlhlariktlrqqyagvrigysthedpdlme pimlavaqgatvfekhvglptdqyginnysanpeqvrrwlaaaaralamlgdgeddavseteqaslrsl rrgvfatrpvaagealtadnvsfafppvegqltanewskyvrytaktpiaadapvmaadlepvnlrdkv qkaveavkalfkrgkivvpgrseleishhygmehfheygltmvtvvnreyckklivmlpgqthpeqyhh kkeetfivlygemtiwlddeerqaqagdvitvqrgvrhrfhsrngvvfeeissthyvddsyytderisa nqdrktrltywm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.49 Rfree 0.278
    Matthews' coefficent 3.01 Rfactor 0.208
    Waters 125 Solvent Content 59.07

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch