.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gaz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of alcohol dehydrogenase superfamily protein from Novosphingobium aromaticivorans. To be Published
    Site NYSGXRC
    PDB Id 3gaz Target Id NYSGXRC-11160o
    Molecular Characteristics
    Source Novosphingobium aromaticivorans
    Alias Ids TPS27090,YP_498038.1, 3.40.50.720 Molecular Weight 35988.02 Da.
    Residues 343 Isoelectric Point 5.85
    Sequence mttptmiaavveeangpfvlrklarpqpapgqvlvqieasgtnpldakirageaphaqqplpailgmdl agtvvavgpevdsfrvgdavfgltggvgglqgthaqfaavdarllaskpaaltmrqasvlplvfitawe glvdraqvqdgqtvliqgggggvghvaiqialargarvfatargsdleyvrdlgatpidasrepedyaa ehtagqgfdlvydtlggpvldasfsavkrfghvvsclgwgthklaplsfkqatysgvftlhtllanegl ahfgemlreadalvqtgklaprldprtfsiaeigsaydavlgrndvprqrgkiaitvepqfnlheqr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.96 Rfree 0.261
    Matthews' coefficent 2.14 Rfactor 0.225
    Waters 697 Solvent Content 42.62

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch