The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of gluconate kinase from Lactobacillus acidophilus. To be Published
    Site NYSGXRC
    PDB Id 3gbt Target Id NYSGXRC-11200e
    Molecular Characteristics
    Source Lactobacillus acidophilus
    Alias Ids TPS27124,PF00370, YP_193277.1, 3.30.420.40 Molecular Weight 54337.78 Da.
    Residues 494 Isoelectric Point 8.77
    Sequence mkyiigmdvgttatkgvlydingkavasvskgypliqtkvgqaeedpklifdavqeiifdltqkidgki aaiswssqmhsliglgsddelltnsitwadncaksivqdaknrgfaqqiyrktgmpmhpmapiykllwl knkktevfsqaqkwigikeyiifrltgklvtdttmaagtgilnlktltwdqelldilkikkeqlpkiaq ptkvifpikteyvkklgidsdtkiilgasdgylstigvnaidsdhcalnvgtsgairtivdqpkidpsa syfcypadkthyllggpvnnggivfnwarqtlfdadetpqdfldvaqtapagsrnliflpylggerapi wdanargsfvgltrmhqkpemaraviegiifnlydaasnlikntkkpvainatggflksdfvrqlcani fnvpivtmkeqqsgtlaamflarqalglnqdlseigqfaqadkvyfpnpkeaatyqklfplyceirnal aasygkfsnin
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.2306
    Matthews' coefficent 3.82 Rfactor 0.1992
    Waters 131 Solvent Content 67.79

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch