.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gbv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative LacI transcriptional regulator from Bacteroides fragilis. To be Published
    Site NYSGXRC
    PDB Id 3gbv Target Id NYSGXRC-11231j
    Molecular Characteristics
    Source Bacteroides fragilis
    Alias Ids TPS27150,3.40.50.2300, PF00532, YP_212337.1 Molecular Weight 40666.06 Da.
    Residues 354 Isoelectric Point 5.86
    Sequence mnklperirikdiarlanvsvgtvdrvlhgrsgvseasrkrveeilkqldyqpnmyasalasnkkytfa cllpkhlegeywtdvqkgireavttysdfnisanithydpydynsfvatsqavieeqpdgvmfaptvpq ytkgftdalnelgipyiyidsqikdapplaffgqnshqsgyfaarmlmllavndreivifrkihegvig snqqesreigfrqymqehhpacnilelnlhadlniedsrmlddffrehpdvkhgitfnskvyiigeylq qrrksdfsligydllernvtclkegtvsfliaqqpelqgfnsiktlcdhlifrkevactnympidlltk enidyyhsk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.240
    Matthews' coefficent 2.36 Rfactor 0.210
    Waters 198 Solvent Content 47.82

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 6
    Metals NA (SODIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch