.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gbw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of PHR domains from Mus musculus Phr1 (Mycbp2) explain the loss-of-function mutation (Gly1092-->Glu) of the C. elegans ortholog RPM-1. J.Mol.Biol. 397 883-892 2010
    Site NYSGXRC
    PDB Id 3gbw Target Id NYSGXRC-13170b
    Related PDB Ids 3hwj 
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS27034,NP_997098 Molecular Weight 520826.85 Da.
    Residues 4746 Isoelectric Point 6.71
    Sequence mmmcaataspaaassgpggdgffaaatissspapgalfmpvpdgsvaaaglglglpttdsrghyqllls graladryrriyttalsdrdqagsstghpasrnkkilnkkklkrkqkskskvktrsksenventviipd iklhsnpsafniycnvrhcvlewqkketslaaasknsvqsgesdsdeeeesreppiklpkiievglcev feliketrfshpslclrslqallnvlqgqqpeglqseppevleslfqllleitvrstgmndstgqslta lscaclfslvaswgetgrtlqaisailtnngshacqtiqvptilnslqrsvqavlvgkiqvqdwfsngi kkaalmhkwplkevsvdeddqcllqndgfflyllckdglykigsgysgtvrghiynstsrirnrkekks wlgyaqgyllyrdlnnhsmtairispetleqdgtvllpdchtegqnilftdgeyinqiaasrddgfvvr ifatstepvlqqelqlklarkclhacgislfdlekdlhiistgfdeesailgagrefalmktangkiyy tgkyqslgikqggpsagkwvelpitkspkivhfsvghdgshallvaedgsvfftgsaskgedgestksr rqskpykpkkiikmegkivvytacnngsssviskdgelymfgkdaiysdssslvsdlkghfvtqvamgk ahtcvlmkngevwtfgvnnkgqcgrdtgamnqggkgfgvenmatamdedleeeldekdeksmmcppgmh kwkleqcmvctvcgdctgygascvssgrpdrvpggicgcgsgesgcavcgcckacareldgqearqrgi ldavkemipldlllavpvpgvnieehlqlrqeekrqrvirrhrledgrgplvfagpifmnhreqalarl rshpaqlkhkrdkhkdgsgdrgekdaskittyppgsvrfdcelravqvscgfhhsvvlmengdvytfgy gqhgqlghgdvnsrgcptlvqalpgpstqvtagsnhtavllmdgqvftfgsfskgqlgrpildipywna kpapmpnigskygrkatwigasgdqtflridealinshvlatseifaskhiiglvpasisepppfkcll inkvdgscktfndseqedlqgfgvcldpvydvlwrfrpstrelwcynavvadarlpsatdmqsrcsils pelalptgsralttrshaalhilgcldtlaamqdlkmgiasteeetqavmkvyskedysvvnrfeshgg gwgysahsveairfsadtdillgglglfggrgeytakiklfelgpdggdhetdgdllaetdvlaydcaa rekyammfdepvllqagwwyvawarvsgpssdcgshgqasittddgvifqfksskksnngtdvnagqip qllyrlptsdgstskgkqqtsepvhilkrsfartvsvecfesllsilhwswttlvlgveelrglkgfqf tatlldlerlrfvgtcclrllrvytceiypvsatgkavveetsklaecigktrtllrkilsegvdhcmv kldndpqgylsqplrlleavlqechntftacfhsfyptpalqwaclcdllncldqeanfktsssrllaa vmsalchtsvkltslfpiaydgevllrsivkqvstendstlvhrfpllvghmeklsqseenisgmtsfr evlekmlvivvlpvrnslrreselfsshlvsntcgllasivseltasalgsevdglnslhsvkasanrf tktsqgrswntgngspdaicfavdkpgivvvgfavyggggiheyelevlvddsehagdsthshrwtsle lvkgtyttddspsdiaeirldkvvplkenvkyavrlrnygsrtangdggmttvqcpdgvtftfstcsls sngtnqtrgqipqilyyrsefdgdlqsqllskaneedkncsralsvvstvvraakdllhralavdaddi pellsssslfsmllpliiayigpvaaaipkvavevfglvqqllpsvailnqkyappafnpnqstdsttg nqpeqglsacttsnhyaviesehpykpacvmhykvtfpecvrwmtiefdpqcgtaqsedvirllipvrt iqnsgygakltsvhenlnswvelkkysgssgwptmvlvlpgnealfsletasdyvkddkasfygfkcfa igyefspgpdegviqlekelanlggvcaaalmkkdlalpvgneleedleileeaalqvckthsgilgkg lalshsptilealegnlplqiqsneqsflddfiacvpgssggrlarwlqpdsyadpqktslilnkddir cgwpttitvqtkdqygdvvhvpnmkvevkavpvsqkktslqqdqgkkcqripgspsaaassadmtfggl aspkldvsyepmivkearyiaitmmkvyenysfeelrfasptpkrpsenmlirvnndgtycanwtpgai glytvhvtidgieidaglevkvkdppkgmippgtqlvkpkadpqpnkirkfvakdsaglrirshpslqs eqigivrvngtitfideihnddgvwlrlneetikkyvpnmngyteawclsfnqhlgksllvpvdnifna sqgvrdldvfswtskaffpqepktntddffkdmnscgpqeatmqerdhpflrggpgmykvvktgpsghn irscpnlrgipigmlvlgnkvkavgevtnsegawvqldknsmvefcesdegeawslardrggnqylrhe deqvlldqnsqppppspfsvqafnkgascsaqgfdyglgnnkgdqlsailnsiqsrpnlpapsifdqaa kppsslvhspfvfgqplsfqqrqlqsdrgtistssrpvstsgkselpskhsrsvkpdghvsrtpadqkk prgteglsaseslmlksdaaklrsdshsrslspnhntlqtlksdgrtssgfraespgpgsrssspkpkp lptprsspsgassprssspqdknlpqkstapaktkldpprersksdsytldpdtlrkkkmplteplrgr stspkpkpvpkdpkdspgsenrapsphvvqenlhsevvevctsstlktngvtdstcddsgdlksvdegs nkvhfsigkaplkdeqemraspkisrkcanrhtrpkkeksnflfkgdgtkslepakqamspsvaecara vfasflwhegivhdamacssflkfnpdlskehapirsslnsqppteekeiklknrhsleissalnmfni aphgpdiskmgsinknkvlsmlkepplhekcedgkseatfemsmhhtmksksplpltlqhlvafwedis latikaasqnmifpspgscavlkkkecekenkktkkekkkkekteirprgnlfgemaqlavggpekdti celcgeshpypvtyhmrqahpgcgryaggqgynsighfcggwagncgdggmggstwylvcdrcrekylr ekqaaarekvkqsrrkpmqvktpralptmeahqvikanalfllslssaaepsilcyhpakpfqsqlpiv kegvsedlpvkmpclylqtlarhhhenfvgyqddnlfqdemrylrstsvpapyisvtpdaspnvfeepe snmksmppsletspitdtdlakrtvfqrsysvvaseydkqhsilparvkaiprrrvnsgdtvgssllrh pspelsrlisahsslskgernfqwpvlafviqhhdlegleiamkqalrksacrvfameafnwllcnviq ttslhdilwhfvaaltpspveaeededednksnkenaeqekdtrvcehplsdiviageaahplphtfhr llqtisdlmmslpsgsslqqmalrcwslkfkqsdhqflhqsnvfhhinnilsksddgdseesfsisvqs gfeamsqelcivmclkdltsivdiktssrpamigsltdgstetfwesgdedknktknitincvkginar yvsvhvdnsrdlgnkvtsmtfltgkaveelcrikqvdldsrhigwvtselpggdnqiikielkgpentl rvrqvkvlgwkdgestkiagqisasvaqqrsceaetlrvfrlitsqvfgklisgdaeptpeqeekalls spegeekatsdadlkehmvgiifsrskltnlqkqvcahivqairmeatrvreewehaisskenansqps dedassdaycfellsmvlalsgsnvgrqylaqqltllqdlfsllhtasprvqrqvtsllrrvlpevtpn rlasiigvkslppadisdiihstekgdwnklgildmflgciakaltvqlkakgttitgtagttvgkgvt tvtlpmifnssylrrgeshwwmkgstptqiseiiirlikdmaaghlseawsrvtknaiaetiialtkme eefrspvrciattrlwlalaslcvldqdhvdrlssgrwmgkdgqqkqmpmcdnhddgetaaiilcnicg nlctdcdrflhlhrrtkthqrqvfkeeeeaikvdlhegcgrtklfwlmaladsktmkamvefrehtgkp ttssseacrfcgsrsgtelsavgsvcsdadcqeyakiacskthpcghpcggvrneehclpclhgcdksa ttlkqdaddmcmicftealsaapaiqldcshvfhlqccrrvlenrwlgpritfgfiscpicknkinhiv lkdlldpikelyedvrrkalmrleyeglhkseaittpgvrfyndaagyamnryayyvcykcrkayfgge arcdaeagqgddydprelicgacsdvsraqmcpkhgtdfleykcryccsvavffcfgtthfcnachddfqrmtsipkeelphcpagpkgkqlegtecplhvvhpptgeefalgcgvcrnahtf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.32 Rfree 0.189
    Matthews' coefficent 2.22 Rfactor 0.162
    Waters 217 Solvent Content 44.64

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3gbw
    1. Structures of PHR Domains from Mus musculus Phr1 (Mycbp2) Explain the Loss-of-Function Mutation (Gly1092--> Glu) of the C. elegans Ortholog RPM-1
    P Sampathkumar, SA Ozyurt, SA Miller, KT Bain - Journal of molecular , 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch