.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gd5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ornithine carbamoyltransferase from Gloeobacter violaceus. To be Published
    Site NYSGXRC
    PDB Id 3gd5 Target Id NYSGXRC-9454p
    Molecular Characteristics
    Source Gloeobacter violaceus
    Alias Ids TPS27025,37522670 Molecular Weight 33955.78 Da.
    Residues 313 Isoelectric Point 5.84
    Sequence msaslgatrfrpdllslddldeaqlhalltlahqlkrgervanlhgkvlglvflkastrtrvsftvamy qlggqvidlspsntqvgrgepvrdtarvlgryvdglairtfaqteleeyahyagipvinaltdhehpcq vvadlltirenfgrlaglklayvgdgnnvahslllgcakvgmsiavatpegftpdpavsaraseiagrt gaevqilrdpfeaargahilytdvwtsmgqeaetqhrlqlfeqyqinaallncaaaeaivlhclpahrg eeitdevmegprsriwdeaenrlhaqkavlaalmggr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.10 Rfree 0.271
    Matthews' coefficent 2.50 Rfactor 0.239
    Waters 133 Solvent Content 50.89

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3gd5
    1. New Insight into the Transcarbamylase Family: The Structure of Putrescine Transcarbamylase, a Key Catalyst for Fermentative Utilization of Agmatine
    LM Polo, F Gil-Ortiz, A Cantn, V Rubio - PloS one, 2012 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch