.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gfo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of cbiO1 from clostridium perfringens: Part of the ABC transporter complex cbiONQ. To be published
    Site NYSGXRC
    PDB Id 3gfo Target Id NYSGXRC-13792a
    Molecular Characteristics
    Source Clostridium perfringens
    Alias Ids TPS26974,PF00005, ABG82220.1 Molecular Weight 32112.77 Da.
    Residues 285 Isoelectric Point 7.71
    Sequence medyilkveelnynysdgthalkginmnikrgevtailggngvgkstlfqnfngilkpssgrilfdnkp idysrkgimklresigivfqdpdnqlfsasvyqdvsfgavnmklpedeirkrvdnalkrtgiehlkdkp thclsfgqkkrvaiagvlvmepkvlildeptagldpmgvseimkllvemqkelgitiiiathdidivpl ycdnvfvmkegrvilqgnpkevfaekevirkvnlrlprighlmeilkekdgfvfdeldltigqarktin swknkifnd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.263
    Matthews' coefficent 2.12 Rfactor 0.206
    Waters 31 Solvent Content 41.86

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3gfo
    1. Crystal Structure of Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR)-associated Csn2 Protein Revealed Ca2+-dependent Double-stranded
    KH Nam, I Kurinov, A Ke - Journal of Biological Chemistry, 2011 - ASBMB
     
    2. Receptor-transporter interactions of canonical ATP-binding cassette import systems in prokaryotes
    E Schneider, V Eckey, D Weidlich - European Journal of , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch