.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gg2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of UDP-glucose 6-dehydrogenase from Porphyromonas gingivalis bound to product UDP-glucuronate. To be Published
    Site NYSGXRC
    PDB Id 3gg2 Target Id NYSGXRC-11146l
    Molecular Characteristics
    Source Porphyromonas gingivalis
    Alias Ids TPS27072,3.40.50.720, NP_905351.1 Molecular Weight 57915.44 Da.
    Residues 522 Isoelectric Point 7.46
    Sequence mgqacigsrpisflwevrkcrrfigsytiirrvivshvlsgsrhyipatgrgnsrlsldkaspfyltfv pknsisyynmdiavvgigyvglvsatcfaelganvrcidtdrnkieqlnsgtipiyepglekmiarnvk agrlrfgteieqavpeadivfiavgtpagedgsadmgyvldaarsigramsryilivtkstvpvgsyrl irkviqeeldkrevlidfdiasnpeflkegnaiddfmkpdrvvvgvdsdrarelitslykpmllnnfrv lfmdiasaemtkyaanamlatrisfmndvanlcervgadvsmvrlgigsdsrigskflypgcgyggscf pkdvkalirtaedngyrmevleavervnekqksilfdkfstyykgnvqgrcvaiwglsfkpgtddmrea pslvliekllevgcrvrvydpvamkeaqkrlgdkveyttdmydavrgaealfhvtewkefrmpdwsals qtmaaslvidgrnvyelpadsdftllnignsaiesassk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.70 Rfree 0.256
    Matthews' coefficent 2.34 Rfactor 0.215
    Waters 1307 Solvent Content 47.40

    Ligand Information
    Ligands UGA (URIDINE-5'-DIPHOSPHATE-GLUCURONIC) x 6
    Metals

    Jmol

     
    Google Scholar output for 3gg2
    1. Structure of Burkholderia cepacia UDP-glucose dehydrogenase (UGD) BceC and role of Tyr10 in final hydrolysis of UGD thioester intermediate
    J Rocha, AO Popescu, P Borges - Journal of , 2011 - Am Soc Microbiol
     
    2. Conformational change upon product binding to Klebsiella pneumoniae UDP-glucose dehydrogenase: A possible inhibition mechanism for the key enzyme in
    YY Chen, TP Ko, CH Lin, WH Chen - Journal of structural biology, 2011 - Elsevier
     
    3. Cloning, expression, purification, crystallization and preliminary crystallographic studies of BceC, a UDP-glucose dehydrogenase from Burkholderia cepacia IST408
    J Rocha, AO Popescu, I Sa-Correia - Section F: Structural , 2010 - scripts.iucr.org
     
    4. Structure of a UDP-glucose dehydrogenase from the hyperthermophilic archaeon Pyrobaculum islandicum
    H Sakuraba, T Kawai, K Yoneda - Section F: Structural , 2012 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch