.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gg7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized metalloprotein from Deinococcus radiodurans. To be Published
    Site NYSGXRC
    PDB Id 3gg7 Target Id NYSGXRC-9324b
    Molecular Characteristics
    Source Deinococcus radiodurans
    Alias Ids TPS27007,10957545, PF01026 Molecular Weight 27238.69 Da.
    Residues 244 Isoelectric Point 6.71
    Sequence midfhvhldlypdpvavaraceerqltvlsvtttpaawrgtlalaagrphvwtalgfhpevvseraadl pwfdrylpetrfvgevgldgspslrgtwtqqfavfqhilrrcedhggrilsihsrraesevlncleanp rsgtpilhwysgsvtelrraislgcwfsvgptmvrtqkgaalirsmprdrvltetdgpfleldgqaalp wdvksvveglskiwqipaseverivkenvsrllgtvr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.199
    Matthews' coefficent 1.91 Rfactor 0.183
    Waters 152 Solvent Content 35.68

    Ligand Information
    Ligands SO4 (SULFATE) x 2;MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 1;MRD ((4R)-2-METHYLPENTANE-2,4-DIOL) x 1
    Metals MN (MANGANESE) x 1

    Jmol

     
    Google Scholar output for 3gg7
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch