.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gg9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative D-3-Phosphoglycerate Dehydrogenase from Ralstonia Solanacearum. To be Published
    Site NYSGXRC
    PDB Id 3gg9 Target Id NYSGXRC-11148p
    Molecular Characteristics
    Source Ralstonia solanacearum
    Alias Ids TPS27082,3.40.50.720, NP_518137.1 Molecular Weight 38740.67 Da.
    Residues 353 Isoelectric Point 8.62
    Sequence llrtivrsemsmkiavlddyqdavrkldcfsllqdhevkvfnntvkgvgqlaarvadveaivlirertr vtrqlldrlpklkiisqtgrvsrdagghidleactdkgvvvlegkgspvapaeltwalvmaaqrripqy vaslkhgawqqsglksttmppnfgigrvlkgqtlgifgygkigqlvagygrafgmnvlvwgrenskera radgfavaeskdalfeqsdvlsvhlrlndetrgivtvadltrmkptalfvntsraelveengmvtalnr grpgmaaidvfetepilqghtllrmencictphigyveresyemyfgiafqnildilqgnvdsvanpta lapalira
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.26138
    Matthews' coefficent 2.58 Rfactor 0.19913
    Waters 949 Solvent Content 52.43

    Ligand Information
    Ligands SO4 (SULFATE) x 11;GOL (GLYCEROL) x 6
    Metals CL (CHLORIDE) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch