.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ghf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the septum site-determining protein minC from Salmonella typhimurium. To be Published
    Site NYSGXRC
    PDB Id 3ghf Target Id NYSGXRC-13865a
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS26988,AAV77030.1, PF05209 Molecular Weight 25244.67 Da.
    Residues 235 Isoelectric Point 6.38
    Sequence msntpielkgssftlsvvhlheaepevirqaledkiaqapaflkhapvvinvsglespvnwpelhkivt stglriigvsgckdaslkveidrmglplltegkekavrpapvepatpseppqnanpitktrlidvpvrs gqriyapqcdlivtshvsagaeliadgnihvygmmrgralagasgdreaqifcthltaelvsiagvywl sdkipaefygkaarlrladnaltvqpln
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.295
    Matthews' coefficent 2.20 Rfactor 0.238
    Waters 14 Solvent Content 44.04

    Ligand Information
    Ligands CIT (CITRIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 3ghf
    1. Structure of the Phosphatase Domain of the Cell Fate Determinant SpoIIE from Bacillus subtilis
    VM Levdikov, EV Blagova, AE Rawlings - Journal of Molecular , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch