.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ghy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative ketopantoate reductase from Ralstonia solanacearum MolK2. To be Published
    Site NYSGXRC
    PDB Id 3ghy Target Id NYSGXRC-11148n
    Molecular Characteristics
    Source Ralstonia solanacearum
    Alias Ids TPS27080,3.40.50.720, NP_521480.1 Molecular Weight 33890.45 Da.
    Residues 325 Isoelectric Point 7.59
    Sequence mtricivgagavggylgarlaqageavnvlargatlqalqtvglcltedgvthtlpvhvtdtaaalgvq dlvivavkapalenvaagiapligpdtcvvvamngvpwwfferagplqglrlqavdphgciaraiptrh vlgcvvhltcstaspghvrhgsgrrlilgepaggpsprlaavaarferaglqvecsdaiqrdiwfklwg nmtmnpvsvltgatcdrilddpqvsafclavmdeakaigarigcpiaqsgearcavtrqlgvfktsmlq daeagrgpleidalvasvreisqhvgvptpridallglvrlhaqtrgly
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.27786
    Matthews' coefficent 2.59 Rfactor 0.23145
    Waters 211 Solvent Content 52.56

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3ghy
    1. Detecting subtle functional differences in ketopantoate reductase and related enzymes using a rule-based approach with sequence-structure homology recognition
    S Mondal, C Nagao, K Mizuguchi - Protein Engineering Design , 2010 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch