The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative Thiol:disulfide interchange protein DsbE from Chlorobium tepidum. To be Published
    Site NYSGXRC
    PDB Id 3gl3 Target Id NYSGXRC-11210h
    Molecular Characteristics
    Source Chlorobium tepidum
    Alias Ids TPS27134,PF08534,, AAM72305.1 Molecular Weight 18392.43 Da.
    Residues 170 Isoelectric Point 9.54
    Sequence mkrstlstcrvalfalvlsvglsanahaldkgdkapdfalpgktgvvklsdktgsvvyldfwaswcgpc rqsfpwmnqmqakykakgfqvvavnldaktgdamkflaqvpaeftvafdpkgqtprlygvkgmptsfli drngkvllqhvgfrpadkealeqqilaalggn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.09 Rfree 0.296
    Matthews' coefficent 1.99 Rfactor 0.263
    Waters 201 Solvent Content 38.15

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch