.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gm8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a beta-glycosidase from Bacteroides vulgatus. To be Published
    Site NYSGXRC
    PDB Id 3gm8 Target Id NYSGXRC-12023a
    Molecular Characteristics
    Source Bacteroides vulgatus
    Alias Ids TPS26964,PF02836, YP_001297731.1 Molecular Weight 92751.84 Da.
    Residues 815 Isoelectric Point 8.11
    Sequence mkrillfvciqffllasfagetinfckgwkfhlgdagkgassssyndsqwrilniphdwsiegtykqfe ngtdwqsgflpagiswyrktftipskwknkkvqilfegvylnsevwinghwlgkrpngyisfvydltpy lqegknqiavkvdhskaltgrwytgsgiyrpvyllvsnpthipysgihfrsklqnkqsatytlsieiet qekkpikvktylqapngsiadtsekifvssadslcflsgsirkpllwspdspnvytlicqltrdnkild ecrlpvgfrqlefnpvsgfllngkslkikgvcdhhtvgavgaavpddllhyrlkllkdmgcnairtshn pfspafynlcdtmgimvlnegldgwnqpkaaddygnyfdewwqkdmtdfikrdrnhpsiimwsignevt gatpeiqhnlvslfhqldpdrpvtqggtdptrgmktdyqkkfnyldiigfngngeeigelehfhknypt lcaiatevphtyqtrgvyrsqtqwrrrdfpapwekgninweqfkhrvfpipdltekecfpeesdypyyq ssydnasvrisarkswqrtcsfpwlmgefrwgsfdylgeaewpqrcgnfgiidiaaipkdayflyqslw tdkpmvhllphwthpgkegktipvviytncdavelfinnvslgskpytgeqliwlvpyspgkieargik kgkivatdcyqsaeaphsvalasnkysvkagsdevirieiditdkngipcpyasnelsfhvsgplrllg vdngnptdmfpyqqphcrcfrgkcvvllqsdeekgkgtltvqgtklvekkliievi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.287
    Matthews' coefficent 3.17 Rfactor 0.226
    Waters 256 Solvent Content 61.26

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 3gm8
    1. Solvents derived from glycerol modify classical regioselectivity in the enzymatic synthesis of disaccharides with Biolacta _-galactosidase
    M Prez-Snchez, M Sandoval, A Corts-Cabrera - Green Chem., 2011 - xlink.rsc.org
     
    2. Functional metagenomics unveils a multifunctional glycosyl hydrolase from the family 43 catalysing the breakdown of plant polymers in the calf rumen
    M Ferrer, A Ghazi, A Beloqui, JM Vieites - PloS one, 2012 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch