.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gmg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized conserved protein from Mycobacterium tuberculosis. To be Published
    Site NYSGXRC
    PDB Id 3gmg Target Id NYSGXRC-10023f
    Molecular Characteristics
    Source Mycobacterium tuberculosis
    Alias Ids TPS27178,P64895, PF05949 Molecular Weight 30611.10 Da.
    Residues 292 Isoelectric Point 6.34
    Sequence vsenrpepvaaetsaattarhsqadagahdavrrgrhelpadhprskvgplrrtrlteilrggrsrlvf gtlaillclvlgvaivtqvrqtdsgdsletarpadllvlldslrqreatlnaevidlqntlnalqasgn tdqaalesaqarlaalsilvgavgatgpgvmitiddpgpgvapevmidvinelraagaeaiqindahrs vrvgvdtwvvgvpgsltvdtkvlsppysilaigdpptlaaamnipggaqdgvkrvggrmvvqqadrvdv talrqpkqhqyaqpvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.211
    Matthews' coefficent 2.19 Rfactor 0.183
    Waters 256 Solvent Content 43.89

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3gmg
    1. The progress made in determining the Mycobacterium tuberculosis structural proteome
    MT Ehebauer, M Wilmanns - Proteomics, 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch