The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of putative NADPH:quinone reductase from Bacillus thuringiensis. To be published
    Site NYSGXRC
    PDB Id 3gms Target Id NYSGXRC-11165b
    Molecular Characteristics
    Source Bacillus thuringiensis
    Alias Ids TPS27094,, YP_893774.1 Molecular Weight 36572.19 Da.
    Residues 330 Isoelectric Point 6.87
    Sequence lhgkliqfqkfgnpkdvlqveyknieplkdnevlvrmlvrpinpsdlipitgayahriplpnipgyegv givedvgagvtsdligkrvlplrgegtwqeyvktsadfvvpipdsiddftaaqmyinpltawvtctetl nlqrndvllvnacgsaighlfaqlsqilnfrliavtrnnkhteellrlgaayvidtstaplyetvmtlt nglgadaaidsiggpdgnalafslrpnghfltigllsgvqvnwaeivtkakvhanifhlrhwnkdvppy kwqetfrhlirlvenkqlrfmkvhstydladvkaavdvvqsaektkgkvfltsy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.76 Rfree 0.234
    Matthews' coefficent 2.65 Rfactor 0.199
    Waters 147 Solvent Content 53.59

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch