.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gnl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of uncharacterized protein (LMOf2365_1472) from Listeria monocytogenes serotype 4b. To be Published
    Site NYSGXRC
    PDB Id 3gnl Target Id NYSGXRC-13854a
    Molecular Characteristics
    Source Listeria monocytogenes
    Alias Ids TPS26986,AAT04247.1, PF04816 Molecular Weight 26884.43 Da.
    Residues 240 Isoelectric Point 6.36
    Sequence mkvgnqmneeqlskrlekvasyitkneriadigsdhaylpcfavknqtasfaiagevvdgpfqsaqkqv rssglteqidvrkgnglaviekkdaidtiviagmggtlirtileegaaklagvtklilqpniaawqlre wseqnnwlitseailrednkvyeimvlapsekpvtwtkqeiffgpcllkeqsaifkskwrheantwqni iqtisnnqpvstenqakirelehkialvedvlk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.224
    Matthews' coefficent 2.28 Rfactor 0.196
    Waters 459 Solvent Content 46.15

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3gnl
    1. Crystal structure of Streptococcus pneumoniae Sp1610, a putative tRNA methyltransferase, in complex with S_adenosyl_L_methionine
    HM Ta, KK Kim - Protein Science, 2010 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch