.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gp4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of putative MerR family transcriptional regulator from Listeria monocytogenes. To be published
    Site NYSGXRC
    PDB Id 3gp4 Target Id NYSGXRC-13951a
    Molecular Characteristics
    Source Listeria monocytogenes
    Alias Ids TPS26992,PF00376, AAT05480.1 Molecular Weight 17632.08 Da.
    Residues 151 Isoelectric Point 5.49
    Sequence mtknnisfyvvdaseeltmnikeaseksgvsadtiryyeriglippihrnesgvrkfgaedlrwilftr qmrraglsiealidylalfregehtlearaellkkqrielknridvmqealdrldfkidnydthlipaq eelkdfnversns
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.00 Rfree 0.216
    Matthews' coefficent 3.56 Rfactor 0.182
    Waters 247 Solvent Content 65.49

    Ligand Information
    Ligands GOL (GLYCEROL) x 2;MED (D-METHIONINE) x 1
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 3gp4
    1. Novel bacterial MerR-like regulators their role in the response to carbonyl and nitrosative stress.
    AG McEwan, KY Djoko, NH Chen - Advances in , 2011 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch