.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gpi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of putative NAD-dependent epimerase/dehydratase from methylobacillus flagellatus. To be published
    Site NYSGXRC
    PDB Id 3gpi Target Id NYSGXRC-11161e
    Molecular Characteristics
    Source Methylobacillus flagellatus
    Alias Ids TPS27092,3.40.50.720, YP_546153.1 Molecular Weight 30607.20 Da.
    Residues 277 Isoelectric Point 6.73
    Sequence lskiliagcgdlglelarrltaqghevtglrrsaqpmpagvqtliadvtrpdtlasivhlrpeilvycv aaseysdehyrlsyveglrntlsalegaplqhvffvsstgvygqeveewldedtppiakdfsgkrmlea eallaaysstilrfsgiygpgrlrmirqaqtpeqwparnawtnrihrddgaafiayliqqrshavperl yivtdnqplpvhdllrwladrqgiaypagatppvqgnkklsnarllasgyqliypdyvsgygallaamrp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.44 Rfree 0.226
    Matthews' coefficent 1.85 Rfactor 0.192
    Waters 246 Solvent Content 33.64

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch