.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gpv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a transcriptional regulator, MerR family from Bacillus thuringiensis. To be Published
    Site NYSGXRC
    PDB Id 3gpv Target Id NYSGXRC-11183m
    Molecular Characteristics
    Source Bacillus thuringiensis
    Alias Ids TPS27114,PF09278, 1.10.1660.10, YP_035947.1 Molecular Weight 17083.24 Da.
    Residues 145 Isoelectric Point 9.43
    Sequence mvkslikmalylgnkrmndmyytigqvakmqhltisqiryydkqglfpflqrnekgdrifneealkyle milclkntgmpiqkikqfidwsmegdstilhrlklmkqqeanvlqliqdteknlkkiqqkiakyedeis sanattk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.288
    Matthews' coefficent 2.13 Rfactor 0.268
    Waters 147 Solvent Content 42.14

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3gpv
    1. The d_--d--d_ Vertical Triad Is Less Discriminating Than the a_--a--a_ Vertical Triad in the Antiparallel Coiled-Coil Dimer Motif
    JD Steinkruger, GJ Bartlett, EB Hadley - Journal of the , 2012 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch