.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gqw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a fatty acid amp ligase from e. coli with an acyl adenylate product bound. To be Published
    Site NYSGXRC
    PDB Id 3gqw Target Id NYSGXRC-11191g
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS27118,AAN82156.1, 3.30.300.30, PF00501 Molecular Weight 63571.03 Da.
    Residues 576 Isoelectric Point 5.56
    Sequence vvymsnkifthslpmryadfptlvdaldyaalssagmnfydrrcqledqleyqtlkaraeagakrllsl nlkkgdrvaliaetssefveaffacqyaglvavplaipmgvgqrdswsaklqgllascqpaaiitgdew lplvnaathdnpelhvlshawfkalpeadvalqrpvpndiaylqytsgstrfprgviithrevmanlra ishdgiklrpgdrcvswlpfyhdmglvgflltpvatqlsvdylrtqdfamrplqwlklisknrgtvsva ppfgyelcqrrvnekdlaeldlscwrvagigaepisaeqlhqfaecfrqvnfdnktfmpcyglaenala vsfsdeasgvvvnevdrdileyqgkavapgaetravstfvncgkalpehgieirneagmpvaervvghi cisgpslmsgyfgdqvsqdeiaatgwldtgdlgylldgylyvtgrikdliiirgrniwpqdieyiaeqe peihsgdaiafvtaqekiilqiqcrisdeerrgqlihalaariqsefgvtaaidllpphsiprtssgkp araeakkryqkayaaslnvqesla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.00 Rfree 0.2503
    Matthews' coefficent 2.91 Rfactor 0.1897
    Waters 87 Solvent Content 57.71

    Ligand Information
    Ligands ZZ9 (5'-O-[(S)-HYDROXY{[(1R)-1-) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch