.
The Open Protein Structure Annotation Network
PDB Keyword
.

3grc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a sensor protein from Polaromonas sp. JS666. To be Published
    Site NYSGXRC
    PDB Id 3grc Target Id NYSGXRC-11025b
    Molecular Characteristics
    Source Polaromonas sp. js666
    Alias Ids TPS27044,3.40.50.2300, Q121U0_POLSJ, PF00072 Molecular Weight 88270.50 Da.
    Residues 799 Isoelectric Point 4.99
    Sequence mtpqqnrhillvddmpsihedfrkilaakpgardlddaeaalfgqaaspsgegfeldsayqglegvarv eaavqagrpyamafvdmrmppgldgvetiarlwridpqvqivictaysdypweevlarldaqdrlliik kpfdmievsqlartltakweltrqatlqmgglenavkeraralrasesqlrqitdtvpaliayvdaeqr fqfhnlayeegfglkrdqihgktmremmgdalyekergkieealsgyavqydrvqktadgqlrdyimqy fprygedqdegkvvglfslgtdvtelrridrmksefvstvshelrtpltsirgslgliaggvagelpam akslvgiasnncerlirlindildsekiesgkmhfelqqvelqpllaqalaanegfagqhnvklaldap adavrvsvdsdrltqvvtnllsnavkfsppascvhirllrsggrvrvevadsgpgileefrkrifqkfs qadtsdtrqkggtglglnisraiveqmggsmgfttkagvgtvfhfelpeasplpvedrdsaaprprili ceddpdiarllnlmlekggfdsdmvhsaaqaleqvarrpyaamtvdlnlpdqdgvsliralrrdsrtrd laivvvsanaregelefnsqplavstwlekpidenllilslhraidnmaegkprilhveddldiqriaa aiaqnfatfefactlqeardqlashhydlvlldltlkdgsgwellstiealdpappvvvfsasklnmme sqrveavlvkadtsneelirvlqrvlddslwgtvdsplst
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.21 Rfree 0.265
    Matthews' coefficent 2.30 Rfactor 0.221
    Waters 192 Solvent Content 46.58

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch